PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Lus10006647
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Linaceae; Linum
Family MYB
Protein Properties Length: 262aa    MW: 30101.2 Da    PI: 9.4501
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Lus10006647genomeBGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding27.29.1e-091142132
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmg 32
                     rg W +eEd++l  +v+ +G g+W+t++++ g
      Lus10006647 11 RGLWKPEEDLILRMYVQTHGEGNWATVSAKSG 42
                     788*************************9877 PP

2Myb_DNA-binding46.39.6e-1598143148
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                      rg ++ +E++l+++ +k+ G++ W++Ia +++ gRt++++k++w+++l
      Lus10006647  98 RGDMSDQEQDLIIRMHKLVGNR-WSLIAGRLP-GRTDNEVKNYWNTHL 143
                      7889******************.*********.************996 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS500908.316692IPR017877Myb-like domain
Gene3DG3DSA:1.10.10.602.9E-19741IPR009057Homeodomain-like
SuperFamilySSF466894.52E-7940IPR009057Homeodomain-like
SMARTSM007172.4E-71094IPR001005SANT/Myb domain
PfamPF002491.4E-61140IPR001005SANT/Myb domain
CDDcd001672.93E-51492No hitNo description
Gene3DG3DSA:1.10.10.602.9E-197595IPR009057Homeodomain-like
SuperFamilySSF466896.13E-1978146IPR009057Homeodomain-like
PROSITE profilePS5129423.79893147IPR017930Myb domain
Gene3DG3DSA:1.10.10.605.1E-2296146IPR009057Homeodomain-like
SMARTSM007171.2E-1497145IPR001005SANT/Myb domain
PfamPF002492.9E-1398143IPR001005SANT/Myb domain
CDDcd001673.68E-11101143No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0010026Biological Processtrichome differentiation
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 262 aa     Download sequence    Send to blast
MDDDTQQVKK RGLWKPEEDL ILRMYVQTHG EGNWATVSAK SGLFFFFFVF FFFASPPGLG  60
YLFSLCYSYT KAGFAGLKRG GKSCRLRWKN YLRPNIKRGD MSDQEQDLII RMHKLVGNRW  120
SLIAGRLPGR TDNEVKNYWN THLNNKRLSR VSKRPKTMNS NKNHRRSSKD EKPHQDPQLV  180
SGIKPVVTIG EDNQTTATDD AWIEAAQNMN SYYIESPMPA AARDTALMLD TNEPFIPYLD  240
PFLFFPQPFE CFIGDGDAFF Q*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A4e-187914640107B-MYB
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015579667.18e-70PREDICTED: transcription factor MYB82
TrEMBLA0A061GP131e-66A0A061GP13_THECC; Myb domain protein 82, putative
STRINGPOPTR_0018s12780.14e-66(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF135452026
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G52600.13e-60myb domain protein 82